TP53 S313Afs*32 [nucleoplasm]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
TP53 S313Afs*32 [nucleoplasm] icon
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
TP53, P53
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 313 to 343 by APLPSQRRNHWMENISPFRSVGVSASRCSES
Name Identifier Synonyms
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
Cross References
ZINC - Substances
ZINC target
6SL6, 2H2D, 2X0W, 6RKK, 6W51, 4AGM, 2X0V, 4AGL, 1YC5, 5MCU, 1XQH, 2X0U, 5BUA, 4BV2, 6RKM, 4KVP, 8F2H, 4IJT, 6RM7, 8E7A, 5O1E, 2BIN, 2J1Z, 4AGO, 4ZZJ, 7B4N, 3PDH, 2J20, 6SIO, 4AGN, 5MHC, 6V4F, 5G4N, 2J10, 3IGL, 2Z5T, 5UN8, 5O1B, 1SAF, 2MZD, 5G4O, 2Z5S, 1MA3, 3IGK, 4HJE, 8A31, 7XZX, 7V97, 4LOF, 3DAC, 8A32, 8DC4, 6T58, 7XZZ, 6V4H, 5O1C, 3DAB, 4BUZ, 5MCV, 6XRE, 6VR1, 1UOL, 6GGA, 6VRN, 6VQO, 2BIQ, 1AIE, 5HPD, 2J21, 6LHD, 2L14, 4MZR, 6SIQ, 4RP6, 3D09, 7NMI, 6RKI, 2YBG, 6RM5, 2MWY, 4RP7, 5MG7, 1KZY, 6VRM, 5MCT, 7EDS, 3D07, 6S40, 6GGF, 5AOM, 7B4H, 6RK8, 2H1L, 6SIN, 6RWH, 7B4G, 2MWP, 3D05, 7B4B, 2AC0, 3SAK, 2J1Y, 5ECG, 6RWI, 1OLH, 5O1H, 6SI4, 2YDR, 6SI3, 2BIM, 3TG5, 3TS8, 1SAE, 5O1A, 5O1I, 4LOE, 7B4F, 5AOK, 4X34, 5HP0, 5AOL, 7B4E, 5HOU, 4HFZ, 3Q06, 7DVD, 5MOC, 7YGI, 3ZME, 3Q05, 2GS0, 8DC8, 6FF9, 6VR5, 4LO9, 3D0A, 7B4A, 5G4M, 2H2F, 2ATA, 3OQ5, 6GGE, 2FOO, 4IBU, 3KMD, 2H59, 6GGD, 2J1W, 1PET, 7EL4, 5XZC, 6RZ3, 3D08, 7B48, 2FOJ, 4QO1, 6RJZ, 2H4J, 1SAL, 2MWO, 7B49, 4IBQ, 2AHI, 6SI2, 4IBS, 2F1X, 6RL6, 5LAP, 2J11, 7B4D, 5AOI, 2J1X, 7DHZ, 5AOJ, 8DC7, 7DHY, 6R5L, 8E7B, 6RX2, 1OLG, 8A92, 1GZH, 2FEJ, 3D06, 1TUP, 4IBY, 4XR8, 2PCX, 1DT7, 1YCS, 6SIP, 6S3C, 7EAX, 3Q01, 6ZNC, 4MZI, 6SI0, 5OL0, 6SHZ, 4IBT, 5LGY, 8DC6, 7B46, 1PES, 2J0Z, 5AB9, 2XWR, 2WGX, 7B47, 3LW1, 5ABA, 6S9Q, 2BIP, 6RL4, 2ADY, 6S39, 4AGQ, 1TSR, 5MF7, 6RL3, 2H4H, 4AGP, 4IBZ, 2H4F, 2VUK, 7RM4, 5O1F, 6SI1, 1SAK, 2BIO, 6SLV, 5O1G, 1C26, 1JSP, 2OCJ, 2RUK, 7B4C, 6RWS, 7EEU, 1A1U, 4IBV, 5O1D, 6RWU, 4IBW, 2K8F, 2LY4, 1YCR, 1HS5, 5MCW, 8F2I, 2MEJ, 7BWN, 6FJ5, 6GGB, 6GGC, 1H26, 3KZ8, 5A7B, 2B3G, 1YCQ
Pharos - Targets
ZINC - Predictions - Purchasable
Interactors (228)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q00987 MDM2  11 0.995 115
 UniProt:P04637 TP53  20 0.98 33
 UniProt:Q09472 EP300  5 0.976 22
 IntAct:EBI-4399559 UBIQ      0.973 21
 UniProt:P03070 LT      0.97 25
 UniProt:Q93009 USP7  2 0.969 23
 UniProt:O15151 MDM4  5 0.964 19
 UniProt:P0CG48 UBC  20 0.96 15
 UniProt:Q92793 CREBBP  4 0.96 17
 UniProt:Q96EB6 SIRT1  1 0.957 18
 IntAct:EBI-1550784 CDKN1A      0.929 22
 UniProt:Q8WTS6 SETD7  1 0.922 11
 UniProt:Q13625 TP53BP2  1 0.903 9
 UniProt:Q96PM5 RCHY1  2 0.892 13
 UniProt:Q14999 CUL7  1 0.888 16
 UniProt:Q8IWT3 CUL9  2 0.887 13
 UniProt:Q07817-1 BCL2L1      0.881 26
 UniProt:Q12888-1 TP53BP1      0.879 17
 UniProt:Q12888 TP53BP1  3 0.87 8
 UniProt:P26447 S10A4      0.848 9
 UniProt:Q13526 PIN1  2 0.846 14
 UniProt:P45481 Crebbp  4 0.845 10
 UniProt:P06463 VE6      0.84 5
 UniProt:Q9UER7 DAXX  13 0.84 12
 UniProt:Q15672 TWIST1  1 0.817 10
 UniProt:Q8WUF5 PPP1R13L  1 0.815 12
 UniProt:P38646 HSP9  6 0.811 6
 UniProt:P03126 VE6      0.807 5
 UniProt:Q9NRG4 SMYD2  1 0.806 6
 UniProt:O14641 DVL2  5 0.778 6
 UniProt:P38936 CDKN1A  5 0.778 5
 UniProt:Q05086 UBE3A  1 0.77 6
 UniProt:Q923E4 Sirt1  2 0.766 4
 UniProt:Q99986 VRK1  2 0.761 11
 UniProt:Q05397 PTK2  11 0.751 13
 UniProt:P09874 PARP1  4 0.75 5
 UniProt:P09429 HMGB1  5 0.74 9
 UniProt:P31947 SFN  1 0.738 5
 UniProt:P53350 PLK1  4 0.737 6
 UniProt:P63279 UBE2I  9 0.737 5
 UniProt:P43356 MAGA2      0.729 7
 UniProt:Q9NPI1 BRD7  1 0.729 9
 UniProt:O14503 BHLHE40  1 0.728 11
 UniProt:Q8N3Y1 FBXW8  1 0.725 7
 UniProt:P63165 SUMO1  11 0.722 3
 UniProt:P32776  1 0.719 7
 UniProt:P32780 GTF2H1  1 0.719 12
 UniProt:Q8NHY2 RFWD2  3 0.717 5
 UniProt:Q96KB5 TOPK      0.715 7
 UniProt:P13693 TCTP      0.715 7
 UniProt:Q16666-2 IFI16      0.715 6
 UniProt:Q13547 HDAC1  2 0.713 7
 UniProt:Q9H2X6 HIPK2  3 0.713 3
 UniProt:P42858 HTT  1 0.709 19
 UniProt:P13569 CFTR  17 0.706 18
 UniProt:P29590 PML  5 0.7 4
 UniProt:Q9BUJ2 HNRNPUL1  1 0.697 12
 UniProt:O95376 ARIH2  1 0.691 5
 UniProt:P61964 WDR5  1 0.69 5
 UniProt:Q15291 RBBP5  1 0.69 5
 UniProt:P02829  11 0.678 8
 UniProt:Q9NRR4 DROSHA  1 0.677 5
 UniProt:P06703 S10A6      0.676 3
 UniProt:P29034 S10A2      0.676 4
 UniProt:P06748 NPM1  11 0.676 6
 UniProt:Q15796 SMAD2  20 0.674 7
 UniProt:Q96M61 MAGBI      0.668 3
 UniProt:P31948 STIP1  1 0.666 4
 UniProt:P04792 HSBP1  3 0.665 3
 UniProt:O60341-1 KDM1A      0.664 6
 UniProt:P26663-PRO_0000037536      0.664 9
 UniProt:P48643 CCT5  1 0.659 3
 UniProt:P03120 VE2      0.658 3
 UniProt:P49841 GSK3B  4 0.658 3
 UniProt:P17844 DDX5  4 0.656 6
 UniProt:P51587 BRCA2  20 0.655 7
 UniProt:Q13362 PPP2R5C  3 0.65 4
 UniProt:Q06587 RING1  1 0.65 7
 UniProt:Q14191 WRN  2 0.647 5
 UniProt:O96017 CHEK2  3 0.646 3
 UniProt:Q9BV47 DUS26      0.645 9
 UniProt:Q86XK2 FBXO11  1 0.645 4
 UniProt:Q06330 RBPJ  1 0.645 5
 UniProt:Q9Y618 NCOR2  2 0.645 7
 UniProt:Q92569 PIK3R3  2 0.644 5
 UniProt:P19784 CSNK2A2  2 0.643 3
 UniProt:Q99615 DNAJC7  2 0.643 4
 UniProt:P61981 YWHAG  1 0.643 5
 IntAct:EBI-1550787 MDM2      0.643 3
 UniProt:O95816 BAG2  1 0.643 4
 UniProt:Q9UPR3 SMG5  1 0.643 3
 UniProt:Q9UBL3 ASH2L  1 0.643 7
 UniProt:P30405 PPIF      0.639 4
 UniProt:Q6NYC1 JMJD6  1 0.639 7
 UniProt:Q96FW1 OTUB1  2 0.632 8
 UniProt:Q9Y3T9 NOC2L  1 0.632 8
 UniProt:P49757 NUMB  1 0.632 5
 UniProt:P30153 PPP2R1A  2 0.628 3
 UniProt:P04019 VE6      0.623 2
 UniProt:Q8N488 RYBP  1 0.623 4
 UniProt:P23297 S100A1  1 0.623 3
 UniProt:Q6PCD5 RFWD3      0.623 5
 UniProt:Q8N726 CDKN2A  12 0.623 3
 UniProt:P04271 S100B  1 0.623 3
 UniProt:P35232 PHB  2 0.619 6
 UniProt:Q9Y265 RUVBL1  1 0.619 10
 UniProt:Q86TM6 SYVN1  1 0.61 5
 UniProt:O14920 IKBKB  3 0.609 2
 UniProt:Q9BWC9 CC106      0.608 3
 UniProt:P89055 P89055      0.602 6
 UniProt:Q05655 PRKCD  12 0.602 4
 UniProt:Q9UHH9 IP6K2  1 0.602 4
 UniProt:P15036 ETS2  2 0.602 4
 UniProt:Q9UHC7 MKRN1  2 0.602 8
 UniProt:Q9P0U4 CXXC1  1 0.597 7
 UniProt:Q13155 AIMP2  1 0.593 6
 UniProt:Q96SB4 SRPK1  2 0.591 3
 UniProt:Q06945 SOX4  1 0.591 4
 UniProt:Q8TAQ5 ZNF420  2 0.591 4
 UniProt:Q9UBF1 MAGC2      0.591 3
 UniProt:O60285 NUAK1  2 0.591 5
 UniProt:P23396 RPS3  2 0.59 4
 UniProt:Q9H3D4 TP63  1 0.589 5
 UniProt:P61978 HNRNPK  2 0.589 2
 UniProt:O14980 XPO1  2 0.589 3
 UniProt:Q96ST3 SIN3A  2 0.589 2
 UniProt:P08047 SP1  1 0.589 6
 UniProt:P22736 NR4A1  2 0.581 6
 UniProt:Q96GM8 TOE1      0.577 3
 UniProt:P61289 PSME3  2 0.576 7
 UniProt:O43847 NRDC      0.576 6
 UniProt:P68400 CSNK2A1  2 0.571 2
 UniProt:O75925 PIAS1  1 0.571 4
 UniProt:Q9H7Z6 KAT8  1 0.564 2
 UniProt:P15884 TCF4  1 0.564 2
 UniProt:P25208 NFYB  1 0.564 6
 UniProt:P06748-1 NPM1      0.564 3
 UniProt:P10415 BCL2  1 0.564 5
 UniProt:P63104 YWHAZ  2