BRCA2 S2697Kfs*31 [cytosol]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
BRCA2 S2697Kfs*31 [cytosol] icon
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 2697 to 2726 by KLLAIKLVVQIPKKWPLLNLQMGGMLLRPS
Name Identifier Synonyms
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
Interactors (29)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q06609 RAD51  2 0.982 46
 UniProt:Q86YC2 PALB2  20 0.972 30
 UniProt:P60896 SEM1  2 0.83 10
 UniProt:Q14565 DMC1  1 0.765 12
 UniProt:Q06609-1 RAD51      0.743 12
 UniProt:P38398 BRCA1  20 0.727 8
 UniProt:Q9BXW9 FANCD2  3 0.688 16
 UniProt:Q9Y253 POLH  2 0.676 6
 UniProt:P04637 TP53  20 0.655 7
 UniProt:Q9UJY1 HSPB8  1 0.643 3
 UniProt:Q9NTI5 PDS5B  4 0.641 26
 UniProt:Q9P0W2 HMG20B  1 0.576 8
 UniProt:P51587 BRCA2  20 0.573 3
 UniProt:Q9GZQ8 MAP1LC3B  3 0.558 2
 UniProt:O43502 RAD51C  1 0.532 5
 UniProt:Q9H410 DSN1  3 0.527 3
 UniProt:Q86XE0 SNX32      0.527 2
 UniProt:Q8NA69 SAXO5      0.527 2
 UniProt:Q9NS26 SPNXA      0.527 2
 UniProt:O95429 BAG4  3 0.527 2
 UniProt:Q15014 MORF4L2  1 0.527 2
 UniProt:Q9NXX6 NSMCE4A  1 0.527 2
 UniProt:Q969H4 CNKSR1  1 0.527 2
 UniProt:Q5SZD1 CF141      0.527 2
 UniProt:P58340 MLF1      0.527 2
 UniProt:O43542 XRCC3  1 0.527 2
 UniProt:Q8IZU3 SYCP3  1 0.463 2
 UniProt:P27694 RPA1  2 0.462 3
 UniProt:P15927 RPA2  2 0.462 3
Cite Us!