ATRX S871Hfs*34 [nucleoplasm]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
Other Identifiers
Participant Of
Other forms of this molecule
Modified Residues
Replacement of residues 871 to 903 by HKKDHLMMLKENKRERLSLQQKAQLIKTRPSWN
Name Identifier Synonyms
brain glioma 0060108
cancer 162 malignant tumor, malignant neoplasm, primary cancer
Cite Us!