ATRX V478Ffs*36 [nucleoplasm]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 478 to 512 by FQQRNKEQIKVPVVNIRNLIEKKNLNMNLPTLLKI
Name Identifier Synonyms
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
brain glioma DOID:0060108
Cross References
Pharos - Targets
HMDB Protein
Cite Us!