ATRX A834Pfs*35 [nucleoplasm]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
Other Identifiers
Participant Of
Other forms of this molecule
Modified Residues
Replacement of residues 834 to 867 by PEPPKKEFQIQKILTLLKMRNTAKKEWIIKGTKI
Name Identifier Synonyms
astrocytoma 3069 astrocytoma of Cerebrum, Astrocytic tumor, astrocytoma of brain (disorder), astroglioma, astrocytoma, no ICD-O subtype (morphologic abnormality), cerebral astrocytoma
cancer 162 malignant tumor, malignant neoplasm, primary cancer
Cite Us!