ACY1 P369Hfs*47 [cytosol]

Stable Identifier
R-HSA-5579105
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Synonyms
Aminoacylase-1, ACY1_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
ACY1
Chain
chain:1-408
Other Identifiers
0000110161
11725891_a_at
11750230_a_at
202740_at
2623442
2623444
2623446
2623447
2623448
2623449
2623450
2623452
2623453
2623454
2623456
2623457
2623459
2623460
2623463
2623464
2623466
2623467
2623468
2623469
37713_at
8080168
95
A_23_P57868
GE57578
GO:0003674
GO:0004046
GO:0005515
GO:0005575
GO:0005576
GO:0005615
GO:0005622
GO:0005737
GO:0005829
GO:0006508
GO:0006520
GO:0006805
GO:0008150
GO:0008233
GO:0008237
GO:0016787
GO:0016810
GO:0042802
GO:0043167
GO:0043226
GO:0044281
GO:0046872
GO:0070062
ILMN_1683883
L07548_at
PH_hs_0016467
TC03002341.hg
TC03003358.hg
g4501900_3p_at
Participant Of
Other forms of this molecule
Modified Residues
Name
Replacement of residues 369 to 414 by HLCCCTTTMNGCMRLCSSVGWTYIHACCLPLPVCLPCPVTAEPWNS
Disease
Name Identifier Synonyms
toxic encephalopathy 3602 Neurotoxicity (disorder), neurotoxicity, neurotoxicity syndrome, neurotoxicity
Cite Us!