RHAG P52Dfs*57

Stable Identifier
R-HSA-5623046
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Synonyms
Ammonium transporter Rh type A, RHAG_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
RHAG, RH50
Chain
chain:1-409
Reference Transcript
Other Identifiers
0002680538
11729757_a_at
11758545_s_at
17019847
206145_at
206146_s_at
211254_x_at
2956507
2956508
2956511
2956512
2956514
2956517
2956520
2956523
2956524
2956527
2956528
2956529
2956531
2956532
2956533
32663_at
46051
55331
6005
8126878
85776_s_at
A0A087WZZ4
A0A0A0MQS8
A_23_P256572
AAC04247
AAC04248
AAF78209
AF031548
AF031549
AF237382
AF237383
AF237384
AF237385
AF237386
AF237387
AK313505
AL121950
AL590244
BAG36285
CAA45883
CAC10519
CAI13085
CCDS4927
CH471081
EAX04337
EAX04338
ENSG00000112077
ENSP00000360217
ENST00000371175
EntrezGene:6005
g2909820_3p_a_at
g4506522_3p_at
g5853261_3p_a_at
GE80905
GO:0002376
GO:0003674
GO:0005575
GO:0005623
GO:0005886
GO:0005887
GO:0006810
GO:0006873
GO:0008092
GO:0008150
GO:0008519
GO:0015670
GO:0015672
GO:0015695
GO:0015696
GO:0015701
GO:0016020
GO:0016021
GO:0022840
GO:0022857
GO:0030154
GO:0030506
GO:0035378
GO:0035379
GO:0042592
GO:0048821
GO:0048856
GO:0055085
GO:0060586
GO:0072488
HGNC:10006
HPA055331
ILMN_1811410
IPR002229
IPR024041
IPR029020
LRG_822
LRG_822t1
MIM:180297
MIM:185000
MIM:268150
NM_000324
NP_000315
PF00909
PH_hs_0024061
PR00342
Q9UHG9
RHAG
RHAG-202
TC06001783.hg
uc003ozk.5
UPI000006D18F
X64594
X64594_at
Participant Of
Other forms of this molecule
Modified Residues
Name
Replacement of residues 52 to 107 by DVPRCTCYDICWVWLPHDLPEEIWLQQCGYQPTRCCFGPPVGHYCTGNPAKPGTEI
Disease
Name Identifier Synonyms
Rh deficiency syndrome 0050641
Cross References
RefSeq
GeneCards
PRO
Orphanet
HMDB Protein