Search results for UniProt:Q9Y287

Showing 1 results out of 1

×

Species

Types

Compartments

Search properties

  • clustered Search

Species

Types

Compartments

Search properties

  • clustered Search

Results (1 results from a total of 1)

Identifier: R-HSA-976878
Species: Homo sapiens
Compartment: extracellular region
Primary external reference: UniProt: ITM2B: UniProt:Q9Y287
The ABri and ADan peptides are extensions of the normal C terminus of ITM2B (BRI). The sequence of ABri results from mutatin of the normal stop codon to R, resulting in an additional 11 residues. The ABri peptide is the last 34 residues of this mutated peptide - EASNCFAIRHFENKFAVETLICSRTVKKNIIEEN. The ADan peptide is the result of a 10 nucleotide insertion between the codons for residue 265 and 266, introducing a frameshift that adds a different extension to the normal peptide. The ADan peptide is the last 34 residues of this mutated peptide, identical to ABri for the first 22 residues. EASNCFAIRHFENKFAVETLICFNLFLNSQEKHY