CLTC(2-1634)-p-7Y ALK(1058-1620) fusion [cytosol]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
fullName evidence="36 37"Clathrin heavy chain 1, CLH1_HUMAN
Locations in the PathwayBrowser
Literature References
PubMed ID Title Journal Year
12750159 ALK activation by the CLTC-ALK fusion is a recurrent event in large B-cell lymphoma

Marynen, P, Simons, A, De Paepe, P, Stul, M, Baens, M, Speleman, F, Brons, P, Praet, M, Laureys, G, Poppe, B, Wlodarska, I, De Wolf-Peeters, C, Verhasselt, B, van Krieken, H, Vandenberghe, P

Blood 2003
External Reference Information
External Reference
Gene Names
initiator methionine:1, chain:2-1675
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Insertion of residues 1058 to 1620 at 1635 from UniProt:Q9UM73 ALK
Replacement of residues 1634 to 1634 by YDGVSSVTQAGVQWRDLGSLQPSRARLPGHVAADHPPA
O4'-phospho-L-tyrosine at 1278
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1282
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1283
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1096
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1358
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1507
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1604
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Cross References
ZINC - Substances
ZINC target
Pharos - Targets
ZINC - Predictions - Purchasable
Cite Us!