Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
fullName evidence="36 37"Clathrin heavy chain 1, CLH1_HUMAN
Locations in the PathwayBrowser
Literature References
PubMed ID Title Journal Year
12750159 ALK activation by the CLTC-ALK fusion is a recurrent event in large B-cell lymphoma

Marynen, P, Simons, A, De Paepe, P, Stul, M, Baens, M, Speleman, F, Brons, P, Praet, M, Laureys, G, Poppe, B, Wlodarska, I, De Wolf-Peeters, C, Verhasselt, B, van Krieken, H, Vandenberghe, P

Blood 2003
External Reference Information
External Reference
Gene Names
initiator methionine:, chain:2-1675
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Insertion of residues 1058 to 1620 at 1635 from UniProt:Q9UM73 ALK
Replacement of residues 1634 to 1634 by YDGVSSVTQAGVQWRDLGSLQPSRARLPGHVAADHPPA
O4'-phospho-L-tyrosine at 1278
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1282
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1283
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1096
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1358
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1507
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1604
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Cross References
ZINC - Substances
ZINC target
Pharos - Targets
ZINC - Predictions - Purchasable
HMDB Protein
Interactors (10)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:P32121 ARRB2  2 0.676 6
 UniProt:Q15398 DLGAP5  1 0.645 4
 UniProt:P13569 CFTR  17 0.615 21
 UniProt:P03372 ESR1  8 0.597 3
 UniProt:Q14164 IKBKE  4 0.589 2
 UniProt:P10636-8 MAPT  3 0.569 11
 UniProt:Q9NYZ3 GTSE1  4 0.564 3
 UniProt:O14920 IKBKB  3 0.536 2
 UniProt:P10242 MYB  1 0.499 4
 UniProt:P49407 ARRB1  5 0.491 3
Cite Us!