BRCA1 V1176Ffs*34 [nucleoplasm]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
BRCA1 V1176Ffs*34 [nucleoplasm] icon
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 1176 to 1208 by FLAKASRKESLAGVLALSPIHIWLRVTEEGPRN
Name Identifier Synonyms
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
ovary serous adenocarcinoma DOID:5744 serous carcinoma of Ovary, malignant ovarian serous tumor
Interactors (44)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q9BX63 BRIP1  2 0.976 28
 UniProt:Q99728 BARD1  13 0.951 17
 UniProt:Q86YC2 PALB2  112 0.909 27
 UniProt:Q99708 RBBP8  4 0.907 12
 UniProt:Q6UWZ7 ABRAXAS1  1 0.818 15
 UniProt:P03372 ESR1  8 0.811 16
 UniProt:O15360 FANCA  1 0.747 5
 UniProt:P51587 BRCA2  2 0.727 8
 UniProt:Q06609 RAD51  2 0.718 6
 UniProt:Q96RL1 UIMC1  1 0.717 10
 UniProt:Q14192 FHL2  1 0.715 6
 UniProt:P16104 H2AX  7 0.714 4
 UniProt:Q12888 TP53BP1  3 0.7 5
 UniProt:P27694 RPA1  2 0.65 3
 UniProt:Q14676 MDC1  6 0.629 4
 UniProt:P78347 GTF2I      0.61 5
 UniProt:P63165 SUMO1  155 0.602 3
 UniProt:Q6PJG6 BRAT1      0.602 6
 UniProt:Q8WX92 NELFB  3 0.602 5
 UniProt:Q61188 Ezh2  1 0.591 5
 UniProt:P61956 SUMO2  5 0.589 2
 UniProt:Q9BXW9 FANCD2  3 0.583 3
 UniProt:Q9GZX5 ZNF350  1 0.581 3
 UniProt:P62140 PPP1CB  4 0.581 3
 UniProt:Q16666 IFI16  1 0.556 9
 UniProt:P04637 TP53  1328 0.544 2
 UniProt:P03126 VE6      0.544 7
 UniProt:P03129 VE7      0.544 5
 UniProt:Q92560 BAP1  1 0.543 3
 UniProt:P38398 BRCA1  166