Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
p-6Y-FLT3 A627delinsEYEYDLKWEFPRENLEFGKVLGSGAFGKVMNA [plasma membrane] icon
Locations in the PathwayBrowser
Literature References
PubMed ID Title Journal Year
18483393 Identification of a novel type of ITD mutations located in nonjuxtamembrane domains of the FLT3 tyrosine kinase receptor

Grundler, R, Schnittger, S, Haferlach, T, Duyster, J, Breitenbuecher, F, Huber, C, Brecht, A, Markova, B, Fischer, T, Carius, B

Blood 2009
External Reference Information
External Reference
Gene Names
FLT3, CD135, FLK2, STK1
signal peptide:1-26, chain:27-993
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 627 to 627 by EYEYDLKWEFPRENLEFGKVLGSGAFGKVMNA
O4'-phospho-L-tyrosine at 589
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 591
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 599
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 768
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 955
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 969
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Name Identifier Synonyms
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
acute myeloid leukemia DOID:9119 Leukemia, Myelocytic, acute, acute myeloblastic leukemia, acute myelogenous leukemia, AML - acute Myeloid Leukemia
Cross References
ZINC - World Drugs
Guide to Pharmacology - Targets
ZINC - FDA approved
ZINC - Substances
ZINC - Biogenic
ZINC target
ZINC - Investigational
ZINC - Metabolites
Pharos - Targets
ZINC - Predictions - Purchasable
HMDB Protein
Cite Us!