ERLIN2(1-185):FGFR1(c.-88-822) fusion

Stable Identifier
R-HSA-8853148
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Locations in the PathwayBrowser
Literature References
PubMed ID Title Journal Year
23558953 Identification of targetable FGFR gene fusions in diverse cancers

Wu, YM, Su, F, Kalyana-Sundaram, S, Khazanov, N, Ateeq, B, Cao, X, Lonigro, RJ, Vats, P, Wang, R, Lin, SF, Cheng, AJ, Kunju, LP, Siddiqui, J, Tomlins, SA, Wyngaard, P, Sadis, S, Roychowdhury, S, Hussain, MH, Feng, FY, Zalupski, MM, Talpaz, M, Pienta, KJ, Rhodes, DR, Robinson, DR, Chinnaiyan, AM

Cancer Discov 2013
External Reference Information
External Reference
Gene Names
ERLIN2, C8orf2, SPFH2, UNQ2441/PRO5003/PRO9924
Chain
chain:1-339
Other Identifiers
11160
11731043_s_at
11731044_at
11731045_s_at
11735259_a_at
11735260_s_at
11741586_a_at
11741587_x_at
11745025_a_at
11745026_a_at
11759837_at
14894
17067902
2025
221542_s_at
221543_s_at
238615_at
3094246
3094247
3094248
3094249
3094250
3094251
3094252
3094253
3094254
3094255
3094256
3094257
3094258
3094259
3094260
3094261
3094262
3094263
3094264
3094265
3094266
3094267
3094269
3094281
3094283
37798_at
49388_at
79608_at
8145835
83018_at
A_23_P123440
A_24_P21266
A_24_P372217
A_33_P3363061
AAH05950
AAH48308
AAH50611
AAH67765
AAQ88475
AAQ89210
AB018790
AK291394
AK297279
AL442077
AY358108
AY358851
BAA36845
BAF84083
BAG59750
BC005950
BC048308
BC050611
BC067765
CAB014894
CAC09443
CCDS34879
CCDS6095
CH471080
E5RHW4
E5RJ09
EAW63365
EAW63366
ENSG00000147475
ENSP00000276461
ENSP00000335220
ENSP00000380405
ENSP00000427847
ENSP00000428112
ENSP00000429903
ENSP00000473292
ENST00000276461
ENST00000335171
ENST00000397228
ENST00000518586
ENST00000519638
ENST00000523107
ENST00000523887
EntrezGene:11160
ERLIN2
ERLIN2-201
ERLIN2-202
ERLIN2-203
ERLIN2-205
ERLIN2-206
ERLIN2-210
ERLIN2-211
g10241715_3p_a_at
GE81734
GO:0003674
GO:0004713
GO:0005515
GO:0005575
GO:0005622
GO:0005623
GO:0005737
GO:0005783
GO:0005789
GO:0005829
GO:0005886
GO:0006464
GO:0006629
GO:0006810
GO:0006950
GO:0007165
GO:0008150
GO:0008202
GO:0008203
GO:0008289
GO:0009056
GO:0009058
GO:0015485
GO:0016020
GO:0016021
GO:0016301
GO:0018108
GO:0019899
GO:0030433
GO:0031625
GO:0032933
GO:0032991
GO:0034641
GO:0043226
GO:0044281
GO:0045121
GO:0045541
GO:0045717
GO:0055085
HGNC:1356
HPA002025
Hs.125849.0.S2_3p_a_at
Hs.143848.0.A1_3p_at
ILMN_1669729
ILMN_1700549
ILMN_2378664
IPR001107
IPR033294
MIM:611225
MIM:611605
NM_001003790
NM_001003791
NM_007175
NP_001003790
NP_001003791
NP_009106
PF01145
PH_hs_0031629
SM00244
TC08000277.hg
uc003xkc.5
uc003xkd.4
uc003xke.5
uc003xkf.6
uc003xkg.5
uc064lxt.1
uc064lxu.1
UPI0000073DE1
UPI0000171C64
UPI00003507FF
XM_005273392
XM_006716280
XM_017013000
XP_005273449
XP_006716343
XP_016868489
Participant Of
Other forms of this molecule
Modified Residues
Name
Replacement of residues 185 to 185 by LVSLKRRIELTVEYPWRCGALSPTSNCRTG
Name
Insertion of residues 1 to 822 at 214 from UniProt:P11362 FGFR1
Coordinate
214
Disease
Name Identifier Synonyms
breast cancer 1612 malignant tumor of the breast, mammary cancer, malignant neoplasm of breast, mammary tumor, primary breast cancer, breast cancer, Ca breast - NOS, breast tumor
Cross References
GeneCards
PRO
Orphanet