SLC35A2 Y145Pfs*76

Stable Identifier
R-HSA-5652114
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Synonyms
UDP-galactose translocator, S35A2_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
SLC35A2, UGALT, UGT, UGTL
Chain
chain:1-396
Other Identifiers
0004060497
11717420_a_at
11717421_a_at
11731249_a_at
11739707_a_at
11752728_x_at
17110654
207439_3p_s_at
207439_s_at
207440_at
209326_at
34229_s_at
34230_r_at
36087
4007591
4007592
4007593
4007594
4007595
4007596
4007597
4007598
4007599
4007600
4007602
4007604
4007609
4007610
4007611
4007612
7355
8172460
A_23_P217208
A_24_P310616
A_33_P3261737
AAH35747
AB042425
AF207550
AK290284
AK292816
AK293415
AK298484
B4DE15
B4DSH7
BAA12673
BAA13545
BAA95614
BAA95615
BAF82973
BAF85505
BAG56922
BAG60694
BC035747
CCDS14311
CCDS35247
CCDS43937
CCDS65253
CCDS65254
CH471224
D84454
D84454_at
D88146
D88146_at
EAW50733
EAW50734
ENSG00000102100
ENSP00000247138
ENSP00000365704
ENSP00000402726
ENSP00000416002
ENSP00000489197
ENSP00000489484
ENST00000247138
ENST00000376521
ENST00000445167
ENST00000452555
ENST00000635285
ENST00000635589
EntrezGene:7355
g1526437_3p_at
g5032210_3p_a_at
g5032210_3p_at
GE57350
GE81538
GO:0000139
GO:0003674
GO:0005351
GO:0005459
GO:0005575
GO:0005622
GO:0005623
GO:0005634
GO:0005737
GO:0005783
GO:0005794
GO:0005975
GO:0006012
GO:0006810
GO:0008150
GO:0008643
GO:0015165
GO:0016020
GO:0016021
GO:0022857
GO:0043226
GO:0044281
GO:0055085
GO:0072334
GO:0090481
HGNC:11022
HPA036087
ILMN_1742731
ILMN_1792135
ILMN_1798885
IPR007271
MIM:300896
MIM:314375
NM_001032289
NM_001042498
NM_001282649
NM_001282651
NM_005660
NP_001027460
NP_001035963
NP_001269578
NP_001269580
NP_005651
PF04142
PH_hs_0001903
PH_hs_0035386
SLC35A2
SLC35A2-201
SLC35A2-204
SLC35A2-207
SLC35A2-209
SLC35A2-215
SLC35A2-217
TC0X001019.hg
uc004dlo.4
uc004dlp.2
uc004dlq.6
uc011mmm.2
uc011mmn.2
uc284raf.1
UPI000002B68C
UPI00000746BA
UPI0000137AEA
UPI0000E25D09
UPI00017A6C35
Participant Of
Other forms of this molecule
Modified Residues
Name
Replacement of residues 145 to 219 by PAEDPDHSAVLRAHAESQPFPAAVGLPAAPLHWRRHCPGTASRWGRPTATGSEPWGRPGSRRGLLSLLRLRRCLL
Disease
Name Identifier Synonyms
infantile epileptic encephalopathy 2481 infantile spasm
Interactors (1)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 IntAct:EBI-10171679 386682      0.556 3