Reactome will be unavailable due to host maintenance from Friday, April 27 at 6pm to Sunday, April 29 at 11:55pm.

During the outage, you may wish to use our mirror site at reactome.ncpsb.org.

SLC2A10 V321Cfs*71

Stable Identifier
R-HSA-5632845
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Synonyms
GLUT10, Solute carrier family 2, facilitated glucose transporter member 10, GTR10_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
SLC2A10, GLUT10
Chain
chain:1-541
Reference Transcript
Other Identifiers
0000510301
11744516_a_at
11744517_a_at
11744518_a_at
16914469
221024_s_at
41015
48553_at
48554_at
55673
8063177
81031
A_23_P210521
A_24_P271323
AAI01658
AAI13424
AAK26294
AAK31911
AF248053
AF321240
AK290961
AL031055
AL137188
BAF83650
BC101657
BC113423
CAB69822
CCDS13402
CH471077
EAW75724
ENSG00000197496
ENSP00000352216
ENST00000359271
EntrezGene:81031
g13540546_3p_s_at
GE62735
GO:0003674
GO:0005215
GO:0005351
GO:0005355
GO:0005575
GO:0005622
GO:0005623
GO:0005737
GO:0005829
GO:0005886
GO:0006810
GO:0008150
GO:0008643
GO:0008645
GO:0012505
GO:0015758
GO:0015992
GO:0016020
GO:0016021
GO:0022857
GO:0022891
GO:0035428
GO:0046323
GO:0048471
GO:0055056
GO:0055085
GO:1904659
HGNC:13444
HPA041015
HPA055673
Hs.305971
ILMN_1663351
ILMN_2120247
IPR003663
IPR005828
IPR005829
IPR020846
MIM:208050
MIM:606145
NM_030777
NP_110404
PF00083
PH_hs_0015715
PR00171
SLC2A10
SLC2A10-201
TC20000366.hg
TC20001244.hg
uc002xsl.4
UPI000012BC8D
XM_011529060
XM_011529061
XM_017028087
XP_011527362
XP_011527363
XP_016883576
Participant Of
Other forms of this molecule
Modified Residues
Name
Replacement of residues 321 to 390 by CPWTQAQAVWLCPMPPGRQASLETLACCRTPLYLPFQGPMRTKGSQSCPLLRKPSPIPDLETPQPLLGWP
Disease
Name Identifier Synonyms
arterial tortuosity syndrome 0050645
Cross References
RefSeq
GeneCards
PRO
Orphanet
HMDB Protein