SLC2A10 V321Cfs*71 [plasma membrane]

Stable Identifier
R-HSA-5632845
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Synonyms
GLUT10, Solute carrier family 2, facilitated glucose transporter member 10, GTR10_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
SLC2A10, GLUT10
Chain
chain:1-541
Reference Transcript
Other Identifiers
0000510301
11744516_a_at
11744517_a_at
11744518_a_at
16914469
221024_s_at
3887455
3887456
3887464
3887465
3887466
3887467
3887468
3887469
3887470
3887471
3887472
3887473
48553_at
48554_at
8063177
81031
A_23_P210521
A_24_P271323
GE62735
GO:0003674
GO:0005351
GO:0005575
GO:0005622
GO:0005737
GO:0005886
GO:0005887
GO:0006810
GO:0007165
GO:0008150
GO:0008643
GO:0008645
GO:0009058
GO:0009790
GO:0010628
GO:0010629
GO:0012505
GO:0015757
GO:0016020
GO:0016021
GO:0022857
GO:0030198
GO:0030511
GO:0030512
GO:0032683
GO:0033300
GO:0042592
GO:0043588
GO:0045454
GO:0048471
GO:0048856
GO:0055056
GO:0055085
GO:0060392
GO:0060840
GO:0070837
GO:0072498
GO:0098708
GO:0150104
GO:1902600
GO:1902729
GO:1902730
GO:1903053
GO:1904659
GO:2001045
ILMN_1663351
ILMN_2120247
PH_hs_0015715
TC20000366.hg
TC20001244.hg
g13540546_3p_s_at
Participant Of
Other forms of this molecule
Modified Residues
Name
Replacement of residues 321 to 390 by CPWTQAQAVWLCPMPPGRQASLETLACCRTPLYLPFQGPMRTKGSQSCPLLRKPSPIPDLETPQPLLGWP
Disease
Name Identifier Synonyms
arterial tortuosity syndrome 0050645
Cross References
RefSeq
OpenTargets
GeneCards
PRO
Orphanet
HMDB Protein
Cite Us!