SLC24A5 L454Ffs*33 [trans-Golgi network membrane]

Stable Identifier
R-HSA-5626326
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Synonyms
Sodium/potassium/calcium exchanger 5, NCKX5_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
SLC24A5, JSX, NCKX5
Chain
signal peptide:1-29, chain:30-500
Reference Transcript
Other Identifiers
0006220102
11732581_a_at
16800764
283652
33538_at
3593020
3593021
3593022
3593023
3593032
3593034
3593035
3593037
3593038
3593041
3593045
3593048
3593049
3593050
72087_at
7983553
A_32_P165047
A_33_P3400688
GO:0003674
GO:0005262
GO:0005515
GO:0005575
GO:0005622
GO:0005737
GO:0005794
GO:0005802
GO:0006810
GO:0006811
GO:0006813
GO:0006814
GO:0006816
GO:0006874
GO:0008150
GO:0008273
GO:0009058
GO:0015293
GO:0015297
GO:0016020
GO:0016021
GO:0019748
GO:0022857
GO:0030154
GO:0030318
GO:0031410
GO:0032588
GO:0034220
GO:0035725
GO:0042470
GO:0042592
GO:0043226
GO:0043473
GO:0048022
GO:0050896
GO:0055085
GO:0070588
GO:0071805
GO:0098656
ILMN_1786045
TC15000375.hg
Participant Of
Other forms of this molecule
Modified Residues
Name
Replacement of residues 454 to 485 by FSSSLQWLETRQKVGNSLPIIILGACYIISSI
Disease
Name Identifier Synonyms
oculocutaneous albinism 0050632
Cross References
RefSeq
OpenTargets
GeneCards
PRO
Orphanet
HMDB Protein
Interactors (1)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q6FHY5 Q6FHY5      0.556 3
Cite Us!