SLC24A5 L454Ffs*33 [trans-Golgi network membrane]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Sodium/potassium/calcium exchanger 5, NCKX5_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
signal peptide:1-29, chain:30-500
Reference Transcript
Other Identifiers
Participant Of
Other forms of this molecule
Modified Residues
Replacement of residues 454 to 485 by FSSSLQWLETRQKVGNSLPIIILGACYIISSI
Name Identifier Synonyms
oculocutaneous albinism 0050632
Cross References
HMDB Protein
Interactors (1)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q6FHY5 Q6FHY5      0.488 2