SLC24A5 L454Ffs*33 [trans-Golgi network membrane]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Sodium/potassium/calcium exchanger 5, NCKX5_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
signal peptide:1-29, chain:30-500
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 454 to 485 by FSSSLQWLETRQKVGNSLPIIILGACYIISSI
Cross References
Guide to Pharmacology - Targets
Pharos - Targets
HMDB Protein
Interactors (1)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q6FHY5 Q6FHY5      0.556 3
Cite Us!