Reactome will be unavailable due to host maintenance from Friday, April 27 at 6pm to Sunday, April 29 at 11:55pm.

During the outage, you may wish to use our mirror site at reactome.ncpsb.org.

SLC24A5 L454Ffs*33

Stable Identifier
R-HSA-5626326
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Synonyms
Sodium/potassium/calcium exchanger 5, NCKX5_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
SLC24A5, JSX, NCKX5
Chain
signal peptide:1-29, chain:30-500
Reference Transcript
Other Identifiers
0006220102
11732581_a_at
16800764
283652
72087_at
7983553
A_33_P3400688
CCDS10128
ENSG00000188467
ENSP00000341550
ENSP00000389966
ENST00000341459
ENST00000449382
EntrezGene:283652
GO:0005262
GO:0005509
GO:0005794
GO:0005802
GO:0005887
GO:0006810
GO:0006811
GO:0006813
GO:0006814
GO:0006816
GO:0006874
GO:0008273
GO:0015293
GO:0015297
GO:0016020
GO:0016021
GO:0030955
GO:0031402
GO:0032588
GO:0034220
GO:0035725
GO:0042470
GO:0048021
GO:0048022
GO:0050896
GO:0055085
GO:0070588
HGNC:20611
Hs.710240
ILMN_1786045
MIM:113750
MIM:609802
NM_205850
NP_995322
PF01699
SLC24A5
SLC24A5-201
SLC24A5-202
TC15000375.hg
uc001zwe.4
uc010bel.4
UPI0000242BC9
UPI000156577B
XM_017022079
XM_017022080
XP_016877568
XP_016877569
Participant Of
Other forms of this molecule
Modified Residues
Name
Replacement of residues 454 to 485 by FSSSLQWLETRQKVGNSLPIIILGACYIISSI
Disease
Name Identifier Synonyms
oculocutaneous albinism 0050632
Cross References
RefSeq
GeneCards
PRO
Orphanet
HMDB Protein
Interactors (1)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:P50222 MEOX2      0.488 2