SLC17A5 T178Nfs*34 [lysosomal membrane]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Sialin, S17A5_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
Reference Transcript
Other Identifiers
Participant Of
Other forms of this molecule
Modified Residues
Replacement of residues 178 to 210 by NFQPCMPCGLLGLPLLKEANFLAFHMQEHSLGQ
Name Identifier Synonyms
inherited metabolic disorder 655 Metabolic hereditary disorder, Inborn Errors of Metabolism, inborn metabolism disorder
Cross References
BRENDA (Homo sapiens)
HMDB Protein