CP D411Tfs*36

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Ceruloplasmin, CERU_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
signal peptide:1-19, chain:20-1065
Reference Transcript
Other Identifiers
Participant Of
Other forms of this molecule
Modified Residues
Replacement of residues 411 to 445 by TQMPPSQIERREALKKSILAFWVLSFGQRWETPSE
Name Identifier Synonyms
aceruloplasminemia 0050711
Cross References
BRENDA (Homo sapiens)
HMDB Protein