CP D411Tfs*36 [extracellular region]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Ceruloplasmin, CERU_HUMAN
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
signal peptide:1-19, chain:20-1065
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 411 to 445 by TQMPPSQIERREALKKSILAFWVLSFGQRWETPSE
Name Identifier Synonyms
aceruloplasminemia DOID:0050711
Cross References
Pharos - Targets
HMDB Protein
Cite Us!