ERLIN2(1-185):FGFR1(c.-88-822) fusion [plasma membrane]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Locations in the PathwayBrowser
Literature References
PubMed ID Title Journal Year
23558953 Identification of targetable FGFR gene fusions in diverse cancers

Wu, YM, Su, F, Kalyana-Sundaram, S, Khazanov, N, Ateeq, B, Cao, X, Lonigro, RJ, Vats, P, Wang, R, Lin, SF, Cheng, AJ, Kunju, LP, Siddiqui, J, Tomlins, SA, Wyngaard, P, Sadis, S, Roychowdhury, S, Hussain, MH, Feng, FY, Zalupski, MM, Talpaz, M, Pienta, KJ, Rhodes, DR, Robinson, DR, Chinnaiyan, AM

Cancer Discov 2013
External Reference Information
External Reference
Gene Names
ERLIN2, C8orf2, SPFH2, UNQ2441/PRO5003/PRO9924
Other Identifiers
Participant Of
Other forms of this molecule
Modified Residues
Replacement of residues 185 to 185 by LVSLKRRIELTVEYPWRCGALSPTSNCRTG
Insertion of residues 1 to 822 at 214 from UniProt:P11362 FGFR1
Name Identifier Synonyms
breast cancer 1612 malignant tumor of the breast, mammary cancer, malignant neoplasm of breast, mammary tumor, primary breast cancer, breast cancer, Ca breast - NOS, breast tumor
Cross References